Daimler.com
Information on Daimler AG, our products, innovations, sustainability, careers and investor relations.
Daimler.com Domain Statistics
Daimler.com competitors
Mercedes-benz Forum
Benzworld.org is the premiere mercedes - benz owner website offering the most comprehensive collectionof mercedes
| | www.benzworld.org
The World of Mercedes-benz South Africa
Welcome to the world of mercedes-benz passenger cars & related services in south africa
| | www.mbworld.co.za
Mercedes-benz België - Personenwagens
Nieuws over personenwagens, bedrijfswagens, occasies en de shop met de mercedes-benz collectie
| | www.mercedes-benz.be
Mercedes - Benz Passion Blog / Mercedes Benz, Smart, Maybach, Amg...
Auto blog um mercedes-benz, smart, amg und maybach
| | blog.mercedes-benz-passion.com
Mercedes-benz Social Publish
Mercedes - benz social publish ist ein angebot für blogger und online - journalisten, die abseits von klassischen media
| | socialpublish.mercedes-benz.com
Apache2 Ubuntu Default Page: it Works
Autonomes fahren, elektromobilität, brennstoffzellen : im zukunftsmagazin von mercedes
| | technicity.daimler.com
Mercedes-benz Abu Dhabi | Luxury Cars
Welcome to mercedes - benz abu dhabi, your gateway to the most luxurious and innovative cars on the market
| | www.emc.mercedes-benz.com
Infoseite zu Allen Auto-, Motrradmarken Und Wohnmobielen
Sie finden alle auto - und motorradmarken sowie wohnmobiele - sparen sie bei ihrer fahrzeugversicherung bares geld
| | autos-von-a-z.tripod.com
View Mercedes-benz in Your Country
Welcome to mercedes - benz middle east, your gateway to the most luxurious and innovative cars on themarket
| | www.mideast.mercedes-benz.com
Mercedes-benz Dubai - Luxury Cars
Welcome to mercedes - benz dubai, your gateway to the most luxurious and innovative cars on the market
| | www.gargash.mercedes-benz.com
Daimler.com Sites with a similar domain name
We found 18 websites. With this list, you can understand how other people are using the domain, similar to yours.
Dfs - Home
| | daimler-financialservices.com
Innovate | Daimler
Daimler trucks north america llc, headquartered in portland, or, is the leading medium- and heavy-duty truck manufacturer in north america. Daimler trucks north america produces and markets class 4-8 vehicles under the freightliner, western star and thoma
| | daimler-trucksnorthamerica.com
Daimler-truckfinancial.com
| | daimler-truckfinancial.com
Official Website of Daimler India Commercial Vehicles | Bharatbenz...
India commercial vehicles bharatbenz, mercedes-benz and fuso trucks manufacturer. Commercial vehicles featuring heavy-duty trucks, medium-duty trucks, tippers and tractor-trailer manufactured in daimler india
| | daimler-indiacv.com
Home Daimler
Information on daimler ag, our products, innovations, sustainability, careers and investor relations
| | daimler-benz.com
Home Daimler
Information on daimler ag, our products, innovations, sustainability, careers and investor relations
| | daimlerbenz.com
Daimler Und Benz Stiftung - Willkommen
Daimler und benz stiftung
| | daimler-benz-stiftung.de
Startseite Daimler Protics
Daimler protics gmbh, it-beratung, produktdatenmanagement, virtual engineering,tochterunternehmen daimler ag
| | daimler-protics.de
Daimler Financial Services Japan - ホーム
| | daimler-financialservices.jp
Daimler Fleet Management - Startseite
Home meta-description
| | daimler-fleetmanagement.de
Daimler Tss
Daimler tss ist der it-partner des weltweit bekannten konzerns & bietet für diesen exklusive wie innovative leistungen an
| | daimler-tss.de
Daimler Bigband
Daimler bigband - die bigband
| | daimler-bigband.de
Home - Daimler Fighting Vehicles
Daimler-fighting-vehicle, daimler armoured car, daimler dingo scout car, daimler ferret, dingo scout car, dingo recce car,bsa light tank, tank wheeled
| | daimler-fighting-vehicles.co.uk
Daimler-truckfinancial.ca
| | daimler-truckfinancial.ca
Tani Kredyt Samochodowy
Poszukujesz dobrego kredytu samochodowego na atrakcyjnych warunkach? sprawdź wszelkie dostępne opcje takiego zobowiązania finansowego!
| | daimlerchryslerfinancialservices.pl
Mercedes-benz South Africa
Established in 1954, the mercedes-benz group of companies in south africa is on of the largest automotive groups in south africa read more online
| | daimlerfleetmanagement.co.za
Index of /
Really useful and helpful resources about chrysler cars, daimler chrysler and chrysler town country
| | daimlerchrysler.ca
Homepage - Daimlerchrysler Services
Daimlerchryslerservices.com
| | daimlerchryslerservices.com
Daimler.com Domain Info
Domain Name: | daimler.com |
Registrar: | Key-Systems GmbH |
See daimler.com whois information |
Daimler.com subdomains
We found 20 subdomains for this website.
After-sales Platform
| | aftersales.i.daimler.com
Annual Report 2008 | Daimler > Home
| | ar2008.daimler.com
Startseite
| | ar2009.daimler.com
Daimler > Annual Report 2010
Daimler - annual report 2010. Innovation from tradition. 125 years ago, gottlieb daimler and carl benz invented the automobile – now we are passionately shaping its future. As automotive pioneers, we see it as both motivation and a duty to continue
| | ar2010.daimler.com
Careers Home Page Daimler > Careers
Attractive and exciting jobs for pupils | students | graduates | professionals.,>> start your career at daimler now!
| | career.daimler.com
Home Daimler
Information on daimler ag, our products, innovations, sustainability, careers and investor relations
| | cms.daimler.com
Sammlung - Daimler Art Collectiondaimler Art Collection
| | collection.daimler.com
Daimler Brand & Design Navigator
| | designnavigator.daimler.com
Global Daimler Supplier Portal
| | efaplis.supplier.daimler.com
Daimler Geschäftsbericht 2007 - Geschäftsbericht 2007
| | gb2007.daimler.com
Daimler.com Contact information :
http://daimler.com/contact - Contact | Daimler |
See daimler.com contact information in whois record |
Daimler.com Popular Links
Show moreWeb Safety
daimler.com is
website. This information is from Google, AVG Threat Labs, McAfee SiteAdvisor, Wot.Is Daimler.com Legal or Not
URLs Requested to be Removed: | 0 |
---|---|
Urls removed: | 0 |
Percent: | 0% |
Summary: | Daimler.com is a legal, because it is not contained in the list of sites - https://transparencyreport.google.com/copyright/domains/ |
Daimler.com Visitors Localization
Traffic Estimations | |
---|---|
Traffic Rank | 14,348th most visited website in the World |
germany | 32.9 | united states | 16.7 |
south korea | 6.3 | india | 4.7 |
china | 3.2 |
Website categories
daimler 1'475 sites | mercedes-benz 11'960 sites |
Daimler.com Top Keywords
This report shows links that we found on other domains than the index page. You can use this list of domains in order to understand what content users like.
Keyword | Position | Date |
---|---|---|
daimler adresse | 1 | 2016-02-15 |
job initiative neuss 2012 | 1 | 2016-02-14 |
first car | 1 | 2016-02-12 |
erste motor | 1 | 2016-02-12 |
daimler chrysler historical stock prices | 1 | 2016-02-11 |
daimler benz ag | 1 | 2016-02-11 |
daimler mitarbeiter | 1 | 2016-02-05 |
mercedes benz sindelfingen | 1 | 2016-02-05 |
mercedes-benz trucks | 1 | 2016-02-03 |
evobus stellen | 1 | 2016-02-02 |
Daimler.com Backlinks History
At the last check on 2018-08-16, we found 931 backlinks. The highest value is 931, the lowest value is 931, the average is 931.
Daimler.com Anchors Cloud
Anchors Cloud: List of most used anchor phrases in the anchor tags of the referring domains. An example would be "webstatsdomain" in "<a href="https://webstatsdomain.org">webstatsdomain</a>"
- <a>image</a>( 39% )
- daimler( 17% )
- daimler ag( 14% )
- data protection( 12% )
- careers and investor relations: daimler ag( 7% )
- www.daimler.com( 4% )
- mercedes-benz baut suv-kapazitäten in den usa aus( 4% )
Daimler.com Terms Cloud
List of most used terms in the anchor text of the referring domains. An example would be "Webstatsdomain" in "<a href="https://webstatsdomain.org">Free website statistics, analysis, review - Webstatsdomain</a>"
- daimler( 23% )
- <a>image</a>( 7% )
- data( 7% )
- protection( 7% )
- careers( 7% )
- investor( 7% )
- relations( 7% )
- mercedes-benz( 7% )
- baut( 7% )
- suv-kapazitäten( 7% )
- usa( 7% )
Daimler.com Websites hosted on same IP
Startseite Daimler
Informationen zur daimler ag, unseren produkten, innovationen, nachhaltigkeit, karriere sowie investor relations
| | www.maybach-manufaktur.com
Home Daimler
Information on daimler ag, our products, innovations, sustainability, careers and investor relations
| | www.daimler.de
Startseite Daimler
Informationen zur daimler ag, unseren produkten, innovationen, nachhaltigkeit, karriere sowie investor relations
| | www.maybach-manufacture.jp
Startseite Daimler
Informationen zur daimler ag, unseren produkten, innovationen, nachhaltigkeit, karriere sowie investor relations
| | www.maybach-manufaktur.se
Startseite Daimler
Informationen zur daimler ag, unseren produkten, innovationen, nachhaltigkeit, karriere sowie investor relations
| | www.maybachmanufaktur.com
Startseite Daimler
Informationen zur daimler ag, unseren produkten, innovationen, nachhaltigkeit, karriere sowie investor relations
| | www.maybach.se
Платный Видеочат - Www.maybachmanufacture.ru
Вирт секс чат и виртуальная любовь с женщинами на нашем сайте. Рунетки и бонгакамс - это лучшие эротические видеочаты. - www.maybachmanufacture.ru
| | www.maybachmanufacture.ru
Startseite Daimler
Informationen zur daimler ag, unseren produkten, innovationen, nachhaltigkeit, karriere sowie investor relations
| | www.maybach-manufaktur.us
Startseite Daimler
Informationen zur daimler ag, unseren produkten, innovationen, nachhaltigkeit, karriere sowie investor relations
| | www.maybach.fi
Startseite Daimler
Informationen zur daimler ag, unseren produkten, innovationen, nachhaltigkeit, karriere sowie investor relations
| | www.maybach.es
Daimler.com Website Load Time
Website load time is an important factor, because Google is taking the site’s loading speed into consideration in determining its ranking. Even though this will not have a big impact, it is still something we (webmasters) should really look into. The reason is pretty simple – the majority of visitors are usually in a rush and no one is fond of waiting half a century before the website finally loads its content or fails to load. At the last check on 2016-08-30, website load time was 1.88. The highest load time is 2.81, the lowest load time is 1.24, the average load time is 2.08.